![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.202: Superantigen MAM [101343] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.202.1: Superantigen MAM [101344] (1 family) ![]() automatically mapped to Pfam PF09245 |
![]() | Family a.202.1.1: Superantigen MAM [101345] (2 proteins) |
![]() | Protein Superantigen MAM [101346] (1 species) |
![]() | Species Mycoplasma arthritidis [TaxId:2111] [101347] (3 PDB entries) |
![]() | Domain d2icwh_: 2icw H: [137252] Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwb2, d2icwd1, d2icwd2, d2icwe1, d2icwe2, d2icwj1, d2icwj2, d2icwl2, d2icwl3 automated match to d1r5id_ |
PDB Entry: 2icw (more details), 2.41 Å
SCOPe Domain Sequences for d2icwh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icwh_ a.202.1.1 (H:) Superantigen MAM {Mycoplasma arthritidis [TaxId: 2111]} mklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrhaf givndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndlsy fisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwfr sllvkgvylikryyegdielkttsdfakavfed
Timeline for d2icwh_: