Lineage for d2icwe2 (2icw E:1-92)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719844Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 719896Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)
  8. 719903Domain d2icwe2: 2icw E:1-92 [137250]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwd1, d2icwd2, d2icwe1, d2icwg1, d2icwh1
    automatically matched to d1d5xb2
    mutant

Details for d2icwe2

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: Crystal structure of a complete ternary complex between TCR, superantigen, and peptide-MHC class II molecule
PDB Compounds: (E:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2icwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwe2 d.19.1.1 (E:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d2icwe2:

Click to download the PDB-style file with coordinates for d2icwe2.
(The format of our PDB-style files is described here.)

Timeline for d2icwe2: