SCOPe 2.08: Domain d2icwe2: 2icw E:1-92

Lineage for d2icwe2 (2icw E:1-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)

8. Domain d2icwe2: 2icw E:1-92 [137250]
   Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwd1, d2icwd2, d2icwe1, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl2, d2icwl3
   automatically matched to d1d5xb2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2icwe2

PDB Entry: 2icw, 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule

PDB Compounds: (E:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2icwe2:

Sequence; same for both SEQRES and ATOM records:

>d2icwe2 d.19.1.1 (E:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d2icwe2:

• d2icwe2 first appeared in SCOP 1.73
  
• d2icwe2 appears in SCOPe 2.07