SCOPe 2.08: Domain d2icwd2: 2icw D:13-81

Lineage for d2icwd2 (2icw D:13-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)

8. Domain d2icwd2: 2icw D:13-81 [137248]
   Other proteins in same PDB: d2icwa1, d2icwb1, d2icwb2, d2icwd1, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl2, d2icwl3
   automatically matched to d1k2da2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2icwd2

PDB Entry: 2icw, 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule

PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2icwd2:

Sequence; same for both SEQRES and ATOM records:

>d2icwd2 d.19.1.1 (D:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

Timeline for d2icwd2:

• d2icwd2 first appeared in SCOP 1.73
  
• d2icwd2 appears in SCOPe 2.07