Lineage for d2icwb2 (2icw B:1-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897932Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1897994Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)
  8. 1898001Domain d2icwb2: 2icw B:1-92 [137246]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwd1, d2icwd2, d2icwe1, d2icwg_, d2icwh_, d2icwj1, d2icwl_
    automatically matched to d1d5xb2

Details for d2icwb2

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2icwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icwb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2icwb2:

Click to download the PDB-style file with coordinates for d2icwb2.
(The format of our PDB-style files is described here.)

Timeline for d2icwb2: