Lineage for d2icwb1 (2icw B:93-190)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292026Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1292034Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1292065Domain d2icwb1: 2icw B:93-190 [137245]
    Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb2, d2icwd1, d2icwd2, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwl_
    automatically matched to d1d5xb1

Details for d2icwb1

PDB Entry: 2icw (more details), 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2icwb1:

Sequence, based on SEQRES records: (download)

>d2icwb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d2icwb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtl
vmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d2icwb1:

Click to download the PDB-style file with coordinates for d2icwb1.
(The format of our PDB-style files is described here.)

Timeline for d2icwb1: