SCOPe 2.08: Domain d2icwa1: 2icw A:83-179

Lineage for d2icwa1 (2icw A:83-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2icwa1: 2icw A:83-179 [137243]
   Other proteins in same PDB: d2icwa2, d2icwb1, d2icwb2, d2icwd2, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl2, d2icwl3
   automatically matched to d1k2da1

Details for d2icwa1

PDB Entry: 2icw, 2.41 Å

PDB Description: crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2icwa1:

Sequence; same for both SEQRES and ATOM records:

>d2icwa1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

Timeline for d2icwa1:

• d2icwa1 first appeared in SCOP 1.73
  
• d2icwa1 appears in SCOPe 2.07