![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d2icwa1: 2icw A:83-179 [137243] Other proteins in same PDB: d2icwa2, d2icwb1, d2icwb2, d2icwd2, d2icwe1, d2icwe2, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl2, d2icwl3 automatically matched to d1k2da1 |
PDB Entry: 2icw (more details), 2.41 Å
SCOPe Domain Sequences for d2icwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icwa1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred hlfrkfhylpflpstedvydcrvehwgldepllkhwe
Timeline for d2icwa1: