Lineage for d2icsa1 (2ics A:4-54,A:322-371)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811542Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 811543Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 811724Family b.92.1.8: Adenine deaminase [141689] (1 protein)
  6. 811725Protein Putative adenine deaminase EF0837 [141690] (1 species)
  7. 811726Species Enterococcus faecalis [TaxId:1351] [141691] (1 PDB entry)
    Uniprot Q837K0 2-52,320-369
  8. 811727Domain d2icsa1: 2ics A:4-54,A:322-371 [137241]
    Other proteins in same PDB: d2icsa2
    complexed with ade, lcx, zn

Details for d2icsa1

PDB Entry: 2ics (more details), 2.3 Å

PDB Description: crystal structure of an adenine deaminase
PDB Compounds: (A:) Adenine Deaminase

SCOP Domain Sequences for d2icsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icsa1 b.92.1.8 (A:4-54,A:322-371) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]}
dydllikngqtvngmpveiaikekkiaavaatisgsaketihlepgtyvsaXtleigkda
dltiftiqaeektltdsngltrvakeqirpiktiiggqiydn

SCOP Domain Coordinates for d2icsa1:

Click to download the PDB-style file with coordinates for d2icsa1.
(The format of our PDB-style files is described here.)

Timeline for d2icsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2icsa2