Lineage for d2icna2 (2icn A:5-183)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719992Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 719993Species Human (Homo sapiens) [TaxId:9606] [54488] (8 PDB entries)
  8. 720004Domain d2icna2: 2icn A:5-183 [137238]
    Other proteins in same PDB: d2icna1
    automatically matched to d1zaga2
    complexed with bma, co3, man, nag, p6g

Details for d2icna2

PDB Entry: 2icn (more details), 3.23 Å

PDB Description: Crystal Structure of the complex formed between MHC-like zinc alpha2-glycoprotein and prolactin inducible protein at 3 A resolution
PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d2icna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icna2 d.19.1.1 (A:5-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
qdsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdy
iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOP Domain Coordinates for d2icna2:

Click to download the PDB-style file with coordinates for d2icna2.
(The format of our PDB-style files is described here.)

Timeline for d2icna2:

  • d2icna2 is new in SCOP 1.73
  • d2icna2 does not appear in SCOP 1.75