SCOP 1.73: Domain d2icna1: 2icn A:184-277

Lineage for d2icna1 (2icn A:184-277)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
   fat depleting factor related to class I MHC

7. Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries)

8. Domain d2icna1: 2icn A:184-277 [137237]
   Other proteins in same PDB: d2icna2
   automatically matched to d1zagb1
   complexed with bma, co3, man, nag, p6g

Details for d2icna1

PDB Entry: 2icn, 3.23 Å

PDB Description: Crystal Structure of the complex formed between MHC-like zinc alpha2-glycoprotein and prolactin inducible protein at 3 A resolution

PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d2icna1:

Sequence; same for both SEQRES and ATOM records:

>d2icna1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwea

Timeline for d2icna1:

• d2icna1 is new in SCOP 1.73
  
• d2icna1 does not appear in SCOP 1.75