SCOPe 2.06: Domain d2icaa2: 2ica A:129-306

Lineage for d2icaa2 (2ica A:129-306)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
   Uniprot P20701 153-334

8. Domain d2icaa2: 2ica A:129-306 [137236]
   Other proteins in same PDB: d2icaa3
   automated match to d1lfaa_
   complexed with 2ic

Details for d2icaa2

PDB Entry: 2ica, 1.56 Å

PDB Description: cd11a (lfa1) i-domain complexed with bms-587101 aka 5-[(5s, 9r)-9-(4- cyanophenyl)-3-(3,5-dichlorophenyl)-1-methyl-2,4-dioxo-1,3,7- triazaspiro [4.4]non-7-yl]methyl]-3-thiophenecarboxylicacid

PDB Compounds: (A:) Integrin alpha-L

SCOPe Domain Sequences for d2icaa2:

Sequence; same for both SEQRES and ATOM records:

>d2icaa2 c.62.1.1 (A:129-306) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
nvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyvk
rkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgni
daakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki

Timeline for d2icaa2:

• d2icaa2 first appeared in SCOP 1.73, called d2icaa1
  
• d2icaa2 was called d2icaa_ in SCOPe 2.05
  
• d2icaa2 appears in SCOPe 2.07
  
• d2icaa2 appears in the current release, SCOPe 2.08