Lineage for d2ic8a1 (2ic8 A:91-272)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633923Fold f.51: Rhomboid-like [144090] (1 superfamily)
    6 transmembrane helices
  4. 2633924Superfamily f.51.1: Rhomboid-like [144091] (2 families) (S)
  5. 2633925Family f.51.1.1: Rhomboid-like [144092] (3 proteins)
    Pfam PF01694; transmembrane serine protease
  6. 2633926Protein GlpG [144095] (1 species)
  7. 2633927Species Escherichia coli [TaxId:562] [144096] (19 PDB entries)
    Uniprot P09391 91-272
  8. 2633938Domain d2ic8a1: 2ic8 A:91-272 [137235]
    complexed with bng

Details for d2ic8a1

PDB Entry: 2ic8 (more details), 2.1 Å

PDB Description: crystal structure of glpg
PDB Compounds: (A:) Protein glpG

SCOPe Domain Sequences for d2ic8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ic8a1 f.51.1.1 (A:91-272) GlpG {Escherichia coli [TaxId: 562]}
eragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmh
ilfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgy
vwlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsl
na

SCOPe Domain Coordinates for d2ic8a1:

Click to download the PDB-style file with coordinates for d2ic8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ic8a1: