Lineage for d2ic2a1 (2ic2 A:466-572)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657431Protein Hedgehog receptor iHog [141061] (1 species)
    Cg9211-PA
  7. 657432Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries)
  8. 657433Domain d2ic2a1: 2ic2 A:466-572 [137233]
    complexed with so4

Details for d2ic2a1

PDB Entry: 2ic2 (more details), 1.3 Å

PDB Description: crystal structure of the first fniii domain of ihog
PDB Compounds: (A:) cg9211-pa

SCOP Domain Sequences for d2ic2a1:

Sequence, based on SEQRES records: (download)

>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ypptppnvtrlsdesvmlrwmvprndglpivifkvqyrmvgkrknwqttndnipygkpkw
nselgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqp

Sequence, based on observed residues (ATOM records): (download)

>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ypptppnvtrlsvmlrwmvprndglpivifkvqyrmvgnwqttndnipygkpkwnselgk
sftasvtdlkpqhtyrfrilavysnndnkesntsakfylqp

SCOP Domain Coordinates for d2ic2a1:

Click to download the PDB-style file with coordinates for d2ic2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ic2a1: