Lineage for d2ibzi1 (2ibz I:4-58)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745953Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 745954Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)
  6. 745955Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 745956Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (5 PDB entries)
  8. 745958Domain d2ibzi1: 2ibz I:4-58 [137228]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf1, d2ibzg1, d2ibzh1, d2ibzx1, d2ibzy1
    automatically matched to d1ezvi_
    complexed with fes, hem, sma, uq6

Details for d2ibzi1

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (I:) Ubiquinol-cytochrome c reductase complex 7.3 kDa protein

SCOP Domain Sequences for d2ibzi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzi1 f.23.14.1 (I:4-58) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOP Domain Coordinates for d2ibzi1:

Click to download the PDB-style file with coordinates for d2ibzi1.
(The format of our PDB-style files is described here.)

Timeline for d2ibzi1: