Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) automatically mapped to Pfam PF05365 |
Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
Protein automated matches [190326] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187144] (1 PDB entry) |
Domain d2ibzi_: 2ibz I: [137228] Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzx_, d2ibzy_ automated match to d1ezvi_ complexed with fes, hec, sma, uq6 |
PDB Entry: 2ibz (more details), 2.3 Å
SCOPe Domain Sequences for d2ibzi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibzi_ f.23.14.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
Timeline for d2ibzi_: