SCOPe 2.08: Domain d2ibzi_: 2ibz I:

Lineage for d2ibzi_ (2ibz I:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)
   automatically mapped to Pfam PF05365

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein automated matches [190326] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187144] (1 PDB entry)

8. Domain d2ibzi_: 2ibz I: [137228]
   Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzx_, d2ibzy_
   automated match to d1ezvi_
   complexed with fes, hec, sma, uq6

Details for d2ibzi_

PDB Entry: 2ibz, 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin

PDB Compounds: (I:) Ubiquinol-cytochrome c reductase complex 7.3 kDa protein

SCOPe Domain Sequences for d2ibzi_:

Sequence; same for both SEQRES and ATOM records:

>d2ibzi_ f.23.14.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

Timeline for d2ibzi_:

• d2ibzi_ first appeared in SCOP 1.73, called d2ibzi1
  
• d2ibzi_ appears in SCOPe 2.07