SCOPe 2.06: Domain d2ibzh_: 2ibz H:

Lineage for d2ibzh_ (2ibz H:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81528] (6 PDB entries)

8. Domain d2ibzh_: 2ibz H: [137227]
   Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzi_, d2ibzx_, d2ibzy_
   automated match to d1ezvh_
   complexed with fes, hem, sma, uq6

Details for d2ibzh_

PDB Entry: 2ibz, 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin

PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 17 kDa protein

SCOPe Domain Sequences for d2ibzh_:

Sequence; same for both SEQRES and ATOM records:

>d2ibzh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

Timeline for d2ibzh_:

• d2ibzh_ first appeared in SCOP 1.73, called d2ibzh1
  
• d2ibzh_ appears in SCOPe 2.05
  
• d2ibzh_ appears in SCOPe 2.07
  
• d2ibzh_ appears in the current release, SCOPe 2.08