Lineage for d2ibzh1 (2ibz H:74-147)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888118Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 888119Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 888120Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 888121Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 888122Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81528] (7 PDB entries)
  8. 888126Domain d2ibzh1: 2ibz H:74-147 [137227]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf1, d2ibzg1, d2ibzi1, d2ibzx1, d2ibzy1
    automatically matched to d1ezvh_
    complexed with fes, hem, sma, uq6

Details for d2ibzh1

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 17 kDa protein

SCOP Domain Sequences for d2ibzh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzh1 f.28.1.1 (H:74-147) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

SCOP Domain Coordinates for d2ibzh1:

Click to download the PDB-style file with coordinates for d2ibzh1.
(The format of our PDB-style files is described here.)

Timeline for d2ibzh1: