Lineage for d2ibze2 (2ibz E:31-86)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887478Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 887479Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 887480Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 887481Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries)
  8. 887485Domain d2ibze2: 2ibz E:31-86 [137224]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibzf1, d2ibzg1, d2ibzh1, d2ibzi1, d2ibzx1, d2ibzy1
    automatically matched to d1ezve2
    complexed with fes, hem, sma, uq6

Details for d2ibze2

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor

SCOP Domain Sequences for d2ibze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibze2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOP Domain Coordinates for d2ibze2:

Click to download the PDB-style file with coordinates for d2ibze2.
(The format of our PDB-style files is described here.)

Timeline for d2ibze2: