![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63741] (7 PDB entries) |
![]() | Domain d2ibze1: 2ibz E:87-215 [137223] Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_ automated match to d1kb9e1 complexed with fes, hec, sma, uq6 |
PDB Entry: 2ibz (more details), 2.3 Å
SCOPe Domain Sequences for d2ibze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibze1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye fdgdkvivg
Timeline for d2ibze1: