![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
![]() | Protein Cytochrome bc1 domain [46677] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (7 PDB entries) |
![]() | Domain d2ibzd1: 2ibz D:62-260 [137221] Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_ automated match to d1kyod1 complexed with fes, hem, sma, uq6 |
PDB Entry: 2ibz (more details), 2.3 Å
SCOPe Domain Sequences for d2ibzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibzd1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp attsqmakdvttflnwcae
Timeline for d2ibzd1: