Lineage for d2ibzd1 (2ibz D:62-260)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760999Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 761000Protein Cytochrome bc1 domain [46677] (3 species)
  7. 761001Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (7 PDB entries)
  8. 761005Domain d2ibzd1: 2ibz D:62-260 [137221]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd2, d2ibze1, d2ibze2, d2ibzf1, d2ibzg1, d2ibzh1, d2ibzi1, d2ibzx1, d2ibzy1
    automatically matched to d1ezvd1
    complexed with fes, hem, sma, uq6

Details for d2ibzd1

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial precursor

SCOP Domain Sequences for d2ibzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzd1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

SCOP Domain Coordinates for d2ibzd1:

Click to download the PDB-style file with coordinates for d2ibzd1.
(The format of our PDB-style files is described here.)

Timeline for d2ibzd1: