Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Domain d2ibzc2: 2ibz C:1-261 [137220] Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_ automated match to d1kb9c2 complexed with fes, hem, sma, uq6 |
PDB Entry: 2ibz (more details), 2.3 Å
SCOPe Domain Sequences for d2ibzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibzc2 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil alfvfyspntlghpdnyipgn
Timeline for d2ibzc2: