SCOPe 2.08: Domain d2ibzc1: 2ibz C:262-385

Lineage for d2ibzc1 (2ibz C:262-385)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (5 PDB entries)

8. Domain d2ibzc1: 2ibz C:262-385 [137219]
   Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
   automated match to d1kb9c1
   complexed with fes, hec, sma, uq6

Details for d2ibzc1

PDB Entry: 2ibz, 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d2ibzc1:

Sequence; same for both SEQRES and ATOM records:

>d2ibzc1 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

Timeline for d2ibzc1:

• d2ibzc1 first appeared in SCOP 1.73
  
• d2ibzc1 appears in SCOPe 2.07