Lineage for d2ibxf_ (2ibx F:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467374Domain d2ibxf_: 2ibx F: [137214]
    Other proteins in same PDB: d2ibxa1, d2ibxc_, d2ibxe_
    automated match to d2ibxb1
    complexed with nag

Details for d2ibxf_

PDB Entry: 2ibx (more details), 2.8 Å

PDB Description: Influenza virus (VN1194) H5 HA
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d2ibxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibxf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp

SCOPe Domain Coordinates for d2ibxf_:

Click to download the PDB-style file with coordinates for d2ibxf_.
(The format of our PDB-style files is described here.)

Timeline for d2ibxf_: