Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein) |
Protein Influenza hemagglutinin (stalk) [58066] (2 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries) |
Domain d2ibxf1: 2ibx F:1-160 [137214] Other proteins in same PDB: d2ibxa1, d2ibxc1, d2ibxe1 automatically matched to 2IBX B:1-160 complexed with nag |
PDB Entry: 2ibx (more details), 2.8 Å
SCOP Domain Sequences for d2ibxf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibxf1 h.3.1.1 (F:1-160) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp
Timeline for d2ibxf1: