Lineage for d2ibxe_ (2ibx E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775855Domain d2ibxe_: 2ibx E: [137213]
    Other proteins in same PDB: d2ibxb1, d2ibxd_, d2ibxf_
    automated match to d1jsma_
    complexed with nag

Details for d2ibxe_

PDB Entry: 2ibx (more details), 2.8 Å

PDB Description: influenza virus (vn1194) h5 ha
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d2ibxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibxe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2ibxe_:

Click to download the PDB-style file with coordinates for d2ibxe_.
(The format of our PDB-style files is described here.)

Timeline for d2ibxe_: