![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (6 species) includes rudiment esterase domain |
![]() | Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries) |
![]() | Domain d2ibxc_: 2ibx C: [137211] Other proteins in same PDB: d2ibxb1, d2ibxd_, d2ibxf_ automated match to d1jsma_ complexed with nag |
PDB Entry: 2ibx (more details), 2.8 Å
SCOPe Domain Sequences for d2ibxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibxc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d2ibxc_: