SCOPe 2.01: Domain d2ibxc_: 2ibx C:

Lineage for d2ibxc_ (2ibx C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (5 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (54 PDB entries)

8. Domain d2ibxc_: 2ibx C: [137211]
   Other proteins in same PDB: d2ibxb1, d2ibxd1, d2ibxf1
   automated match to d1jsma_
   complexed with nag

Details for d2ibxc_

PDB Entry: 2ibx, 2.8 Å

PDB Description: influenza virus (vn1194) h5 ha

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2ibxc_:

Sequence; same for both SEQRES and ATOM records:

>d2ibxc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d2ibxc_:

• d2ibxc_ first appeared in SCOP 1.73, called d2ibxc1
  
• d2ibxc_ was called d2ibxc1 in SCOP 1.75
  
• d2ibxc_ appears in SCOPe 2.02
  
• d2ibxc_ appears in the current release, SCOPe 2.08