Lineage for d2ibxc1 (2ibx C:5-325)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662496Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 662497Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 662542Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 662543Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 662544Species Influenza A virus, different strains [TaxId:11320] [49825] (39 PDB entries)
  8. 662610Domain d2ibxc1: 2ibx C:5-325 [137211]
    Other proteins in same PDB: d2ibxb1, d2ibxd1, d2ibxf1
    automatically matched to 2IBX A:5-325
    complexed with nag

Details for d2ibxc1

PDB Entry: 2ibx (more details), 2.8 Å

PDB Description: Influenza virus (VN1194) H5 HA
PDB Compounds: (C:) Hemagglutinin

SCOP Domain Sequences for d2ibxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibxc1 b.19.1.2 (C:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOP Domain Coordinates for d2ibxc1:

Click to download the PDB-style file with coordinates for d2ibxc1.
(The format of our PDB-style files is described here.)

Timeline for d2ibxc1: