Lineage for d2ibxb1 (2ibx B:1-160)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467372Domain d2ibxb1: 2ibx B:1-160 [137210]
    Other proteins in same PDB: d2ibxa1, d2ibxc_, d2ibxe_
    complexed with nag

Details for d2ibxb1

PDB Entry: 2ibx (more details), 2.8 Å

PDB Description: influenza virus (vn1194) h5 ha
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2ibxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibxb1 h.3.1.1 (B:1-160) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp

SCOPe Domain Coordinates for d2ibxb1:

Click to download the PDB-style file with coordinates for d2ibxb1.
(The format of our PDB-style files is described here.)

Timeline for d2ibxb1: