Lineage for d2ibtd2 (2ibt D:244-413)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741426Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 741427Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 741428Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein)
  6. 741429Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)
  7. 741430Species Thermus aquaticus [TaxId:271] [116737] (6 PDB entries)
  8. 741432Domain d2ibtd2: 2ibt D:244-413 [137208]
    Other proteins in same PDB: d2ibta1, d2ibtd1
    automatically matched to d1aqia2
    complexed with 2pr, 3dr, 6ma, gol, nea

Details for d2ibtd2

PDB Entry: 2ibt (more details), 1.7 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing 2- aminopurine at the target position and an abasic site analog at the target base partner position
PDB Compounds: (D:) modification methylase taqi

SCOP Domain Sequences for d2ibtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibtd2 d.287.1.1 (D:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

SCOP Domain Coordinates for d2ibtd2:

Click to download the PDB-style file with coordinates for d2ibtd2.
(The format of our PDB-style files is described here.)

Timeline for d2ibtd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ibtd1