SCOP 1.75: Domain d2ibta2: 2ibt A:244-413

Lineage for d2ibta2 (2ibt A:244-413)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein)

6. Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)

7. Species Thermus aquaticus [TaxId:271] [116737] (12 PDB entries)

8. Domain d2ibta2: 2ibt A:244-413 [137206]
   Other proteins in same PDB: d2ibta1, d2ibtd1
   automatically matched to d1aqia2
   complexed with 2pr, 3dr, 6ma, gol, nea

Details for d2ibta2

PDB Entry: 2ibt, 1.7 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing 2- aminopurine at the target position and an abasic site analog at the target base partner position

PDB Compounds: (A:) modification methylase taqi

SCOP Domain Sequences for d2ibta2:

Sequence; same for both SEQRES and ATOM records:

>d2ibta2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

Timeline for d2ibta2:

• d2ibta2 first appeared in SCOP 1.73
  
• d2ibta2 appears in SCOPe 2.01
  
• d2ibta2 appears in the current release, SCOPe 2.08