Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.287: DNA methylase specificity domain [116733] (1 superfamily) comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin |
Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) |
Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein) |
Protein DNA methylase TaqI, C-terminal domain [116736] (1 species) |
Species Thermus aquaticus [TaxId:271] [116737] (12 PDB entries) |
Domain d2ibta2: 2ibt A:244-413 [137206] Other proteins in same PDB: d2ibta1, d2ibtd1 automatically matched to d1aqia2 complexed with 2pr, 3dr, 6ma, gol, nea |
PDB Entry: 2ibt (more details), 1.7 Å
SCOP Domain Sequences for d2ibta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibta2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]} rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht
Timeline for d2ibta2: