Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (2 proteins) |
Protein DNA methylase TaqI, N-terminal domain [53369] (1 species) |
Species Thermus aquaticus [TaxId:271] [53370] (11 PDB entries) |
Domain d2ibsa1: 2ibs A:21-243 [137201] Other proteins in same PDB: d2ibsa2, d2ibsd2 automatically matched to d1aqia1 protein/DNA complex; complexed with nea |
PDB Entry: 2ibs (more details), 2.4 Å
SCOPe Domain Sequences for d2ibsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibsa1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlp pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii
Timeline for d2ibsa1: