SCOP 1.73: Domain d2ibsa1: 2ibs A:21-243

Lineage for d2ibsa1 (2ibs A:21-243)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein)

6. Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)

7. Species Thermus aquaticus [TaxId:271] [53370] (6 PDB entries)

8. Domain d2ibsa1: 2ibs A:21-243 [137201]
   Other proteins in same PDB: d2ibsa2, d2ibsd2
   automatically matched to d1aqia1
   complexed with 2pr, 6ma, nea

Details for d2ibsa1

PDB Entry: 2ibs, 2.4 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing 2- aminopurine at the target position

PDB Compounds: (A:) modification methylase taqi

SCOP Domain Sequences for d2ibsa1:

Sequence; same for both SEQRES and ATOM records:

>d2ibsa1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

Timeline for d2ibsa1:

• d2ibsa1 is new in SCOP 1.73
  
• d2ibsa1 appears in SCOP 1.75
  
• d2ibsa1 appears in the current release, SCOPe 2.08