Lineage for d2iboc1 (2ibo C:1-90)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 864067Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families) (S)
  5. 864068Family d.58.48.1: MTH1187-like [89958] (5 proteins)
    Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 864079Protein Hypothetical protein SP2199 [143407] (1 species)
  7. 864080Species Streptococcus pneumoniae [TaxId:1313] [143408] (1 PDB entry)
    Uniprot Q97N67 1-90
  8. 864083Domain d2iboc1: 2ibo C:1-90 [137199]
    automatically matched to 2IBO A:1-90

Details for d2iboc1

PDB Entry: 2ibo (more details), 2.8 Å

PDB Description: X-ray Crystal Structure of Protein SP2199 from Streptococcus pneumoniae. Northeast Structural Genomics Consortium Target SpR31
PDB Compounds: (C:) Hypothetical protein SP2199

SCOP Domain Sequences for d2iboc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iboc1 d.58.48.1 (C:1-90) Hypothetical protein SP2199 {Streptococcus pneumoniae [TaxId: 1313]}
mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
evagqeadnvfanvkinvgeilsideklek

SCOP Domain Coordinates for d2iboc1:

Click to download the PDB-style file with coordinates for d2iboc1.
(The format of our PDB-style files is described here.)

Timeline for d2iboc1: