Lineage for d2ibob1 (2ibo B:1-90)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 726079Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families) (S)
  5. 726080Family d.58.48.1: MTH1187-like [89958] (5 proteins)
    Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 726091Protein Hypothetical protein SP2199 [143407] (1 species)
  7. 726092Species Streptococcus pneumoniae [TaxId:1313] [143408] (1 PDB entry)
  8. 726094Domain d2ibob1: 2ibo B:1-90 [137198]
    automatically matched to 2IBO A:1-90

Details for d2ibob1

PDB Entry: 2ibo (more details), 2.8 Å

PDB Description: X-ray Crystal Structure of Protein SP2199 from Streptococcus pneumoniae. Northeast Structural Genomics Consortium Target SpR31
PDB Compounds: (B:) Hypothetical protein SP2199

SCOP Domain Sequences for d2ibob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibob1 d.58.48.1 (B:1-90) Hypothetical protein SP2199 {Streptococcus pneumoniae [TaxId: 1313]}
mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
evagqeadnvfanvkinvgeilsideklek

SCOP Domain Coordinates for d2ibob1:

Click to download the PDB-style file with coordinates for d2ibob1.
(The format of our PDB-style files is described here.)

Timeline for d2ibob1: