Lineage for d2iboa1 (2ibo A:1-90)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. Family d.58.48.1: MTH1187-like [89958] (5 proteins)
    Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. Protein Hypothetical protein SP2199 [143407] (1 species)
  7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143408] (1 PDB entry)
    Uniprot Q97N67 1-90
  8. Domain d2iboa1: 2ibo A:1-90 [137197]

Details for d2iboa1

PDB Entry: 2ibo (more details), 2.8 Å

PDB Description: X-ray Crystal Structure of Protein SP2199 from Streptococcus pneumoniae. Northeast Structural Genomics Consortium Target SpR31
PDB Compounds: (A:) Hypothetical protein SP2199

SCOPe Domain Sequences for d2iboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iboa1 d.58.48.1 (A:1-90) Hypothetical protein SP2199 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkasialqvlplvqgidriavidqviaylqtqevtmvvtpfetvlegefdelmrilkeal
evagqeadnvfanvkinvgeilsideklek

SCOPe Domain Coordinates for d2iboa1 are not available.

Timeline for d2iboa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ibob_, d2iboc_, d2ibod_