Lineage for d2ibnb1 (2ibn B:37-285)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651135Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 651136Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 651313Family a.211.1.4: MioX-like [140769] (1 protein)
    Pfam PF05153; DUF706
  6. 651314Protein Myo-inositol oxygenase MioX [140770] (2 species)
  7. 651315Species Human (Homo sapiens) [TaxId:9606] [140771] (1 PDB entry)
  8. 651317Domain d2ibnb1: 2ibn B:37-285 [137196]
    automatically matched to 2IBN A:37-285
    complexed with cys, fe, i1n, so4

Details for d2ibnb1

PDB Entry: 2ibn (more details), 1.5 Å

PDB Description: crystal structure of human myo-inositol oxygenase (miox)
PDB Compounds: (B:) Inositol oxygenase

SCOP Domain Sequences for d2ibnb1:

Sequence, based on SEQRES records: (download)

>d2ibnb1 a.211.1.4 (B:37-285) Myo-inositol oxygenase MioX {Human (Homo sapiens) [TaxId: 9606]}
mdrvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdesdpdvdfpns
fhafqtaegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvvf
cdstfqdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafym
irfhsfypwhtgrdyqqlcsqqdlamlpwvrefnkfdlytkcpdlpdvdklrpyyqglid
kycpgilsw

Sequence, based on observed residues (ATOM records): (download)

>d2ibnb1 a.211.1.4 (B:37-285) Myo-inositol oxygenase MioX {Human (Homo sapiens) [TaxId: 9606]}
mdrvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdespnsfhafqt
aegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvvfcdstfq
dnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafymirfhsf
ypwhtgrdyqqlcsqqdlamlpwvrefnkfdlvdklrpyyqglidkycpgilsw

SCOP Domain Coordinates for d2ibnb1:

Click to download the PDB-style file with coordinates for d2ibnb1.
(The format of our PDB-style files is described here.)

Timeline for d2ibnb1: