Lineage for d2ibna1 (2ibn A:38-285)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015233Family a.211.1.4: MioX-like [140769] (1 protein)
    Pfam PF05153; DUF706
  6. 2015234Protein Myo-inositol oxygenase MioX [140770] (2 species)
  7. 2015235Species Human (Homo sapiens) [TaxId:9606] [140771] (1 PDB entry)
    Uniprot Q9UGB7 37-285
  8. 2015236Domain d2ibna1: 2ibn A:38-285 [137195]
    Other proteins in same PDB: d2ibna2, d2ibnb3
    complexed with cys, fe, i1n, so4

Details for d2ibna1

PDB Entry: 2ibn (more details), 1.5 Å

PDB Description: crystal structure of human myo-inositol oxygenase (miox)
PDB Compounds: (A:) Inositol oxygenase

SCOPe Domain Sequences for d2ibna1:

Sequence, based on SEQRES records: (download)

>d2ibna1 a.211.1.4 (A:38-285) Myo-inositol oxygenase MioX {Human (Homo sapiens) [TaxId: 9606]}
drvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdesdpdvdfpnsf
hafqtaegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvvfc
dstfqdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafymi
rfhsfypwhtgrdyqqlcsqqdlamlpwvrefnkfdlytkcpdlpdvdklrpyyqglidk
ycpgilsw

Sequence, based on observed residues (ATOM records): (download)

>d2ibna1 a.211.1.4 (A:38-285) Myo-inositol oxygenase MioX {Human (Homo sapiens) [TaxId: 9606]}
drvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdesddfpnsfhaf
qtaegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvvfcdst
fqdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafymirfh
sfypwhtgrdyqqlcsqqdlamlpwvrefnkfdllpdvdklrpyyqglidkycpgilsw

SCOPe Domain Coordinates for d2ibna1:

Click to download the PDB-style file with coordinates for d2ibna1.
(The format of our PDB-style files is described here.)

Timeline for d2ibna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ibna2