Lineage for d2ibgg1 (2ibg G:100-247)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726365Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 726366Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (4 families) (S)
    zinc-binding motif
  5. 726371Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (2 proteins)
  6. 726372Protein Hedgehog [143496] (1 species)
    lacks the conserved metal ion-binding site
  7. 726373Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143497] (1 PDB entry)
  8. 726376Domain d2ibgg1: 2ibg G:100-247 [137192]
    Other proteins in same PDB: d2ibga1, d2ibga2, d2ibgb1, d2ibgb2, d2ibgc1, d2ibgc2, d2ibgd1, d2ibgd2
    automatically matched to 2IBG E:100-248
    complexed with po4

Details for d2ibgg1

PDB Entry: 2ibg (more details), 2.2 Å

PDB Description: Crystal Structure of Hedgehog Bound to the FNIII Domains of Ihog
PDB Compounds: (G:) Protein hedgehog

SCOP Domain Sequences for d2ibgg1:

Sequence, based on SEQRES records: (download)

>d2ibgg1 d.65.1.2 (G:100-247) Hedgehog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yplvlkqtipnlseytnsasgplegvirrdspkfkdlvpnynrdilfrdeegtgadrlms
krckeklnvlaysvmnewpgirllvteswdedyhhgqeslhyegravtiatsdrdqskyg
mlarlaveagfdwvsyvsrrhiycsvks

Sequence, based on observed residues (ATOM records): (download)

>d2ibgg1 d.65.1.2 (G:100-247) Hedgehog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yplvlkqtipnlseytnsasgplegvfkdlvpnynrdilfrrlmskrckeklnvlaysvm
newpgirllvteswdedyhhgqeslhyegravtiatsdrdqskygmlarlaveagfdwvs
yvsrrhiycsvks

SCOP Domain Coordinates for d2ibgg1:

Click to download the PDB-style file with coordinates for d2ibgg1.
(The format of our PDB-style files is described here.)

Timeline for d2ibgg1: