Lineage for d2ibgb1 (2ibg B:573-667)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657431Protein Hedgehog receptor iHog [141061] (1 species)
    Cg9211-PA
  7. 657432Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries)
  8. 657437Domain d2ibgb1: 2ibg B:573-667 [137184]
    Other proteins in same PDB: d2ibge1, d2ibgf1, d2ibgg1, d2ibgh1
    automatically matched to 2IBG A:573-667
    complexed with po4

Details for d2ibgb1

PDB Entry: 2ibg (more details), 2.2 Å

PDB Description: Crystal Structure of Hedgehog Bound to the FNIII Domains of Ihog
PDB Compounds: (B:) cg9211-pa

SCOP Domain Sequences for d2ibgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibgb1 b.1.2.1 (B:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gaaldpmpvpelleieeysetavvlhwslasdadehlitgyyayyrpsssageyfkatie
gaharsfkiapletatmyefklqsfsaasasefsa

SCOP Domain Coordinates for d2ibgb1:

Click to download the PDB-style file with coordinates for d2ibgb1.
(The format of our PDB-style files is described here.)

Timeline for d2ibgb1: