Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (43 proteins) Pfam PF00041 |
Protein Hedgehog receptor iHog [141061] (1 species) Cg9211-PA |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries) |
Domain d2ibgb1: 2ibg B:573-667 [137184] Other proteins in same PDB: d2ibge1, d2ibgf1, d2ibgg1, d2ibgh1 automatically matched to 2IBG A:573-667 complexed with po4 |
PDB Entry: 2ibg (more details), 2.2 Å
SCOP Domain Sequences for d2ibgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibgb1 b.1.2.1 (B:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gaaldpmpvpelleieeysetavvlhwslasdadehlitgyyayyrpsssageyfkatie gaharsfkiapletatmyefklqsfsaasasefsa
Timeline for d2ibgb1: