Lineage for d2ibba1 (2ibb A:573-667)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657431Protein Hedgehog receptor iHog [141061] (1 species)
    Cg9211-PA
  7. 657432Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries)
  8. 657443Domain d2ibba1: 2ibb A:573-667 [137180]
    automatically matched to 2IBG A:573-667
    complexed with so4

Details for d2ibba1

PDB Entry: 2ibb (more details), 2.4 Å

PDB Description: crystal structure of the first and second fniii domains of ihog
PDB Compounds: (A:) cg9211-pa

SCOP Domain Sequences for d2ibba1:

Sequence, based on SEQRES records: (download)

>d2ibba1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gaaldpmpvpelleieeysetavvlhwslasdadehlitgyyayyrpsssageyfkatie
gaharsfkiapletatmyefklqsfsaasasefsa

Sequence, based on observed residues (ATOM records): (download)

>d2ibba1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gaaldpmpvpelleieeysetavvlhwslahlitgyyayyrpsssageyfkatiegahar
sfkiapletatmyefklqsfsaasasefsa

SCOP Domain Coordinates for d2ibba1:

Click to download the PDB-style file with coordinates for d2ibba1.
(The format of our PDB-style files is described here.)

Timeline for d2ibba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ibba2