![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Hedgehog receptor iHog [141061] (1 species) Cg9211-PA |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries) Uniprot Q9VM64 466-572! Uniprot Q9VM64 573-667 |
![]() | Domain d2ibba1: 2ibb A:573-676 [137180] Other proteins in same PDB: d2ibba3 automated match to d2ibgb1 complexed with so4 |
PDB Entry: 2ibb (more details), 2.4 Å
SCOPe Domain Sequences for d2ibba1:
Sequence, based on SEQRES records: (download)
>d2ibba1 b.1.2.1 (A:573-676) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gaaldpmpvpelleieeysetavvlhwslasdadehlitgyyayyrpsssageyfkatie gaharsfkiapletatmyefklqsfsaasasefsalkqgrtqrp
>d2ibba1 b.1.2.1 (A:573-676) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gaaldpmpvpelleieeysetavvlhwslahlitgyyayyrpsssageyfkatiegahar sfkiapletatmyefklqsfsaasasefsalkqgrtqrp
Timeline for d2ibba1: