Lineage for d2ibba1 (2ibb A:573-676)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. Protein Hedgehog receptor iHog [141061] (1 species)
    Cg9211-PA
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries)
    Uniprot Q9VM64 466-572! Uniprot Q9VM64 573-667
  8. Domain d2ibba1: 2ibb A:573-676 [137180]
    Other proteins in same PDB: d2ibba3
    automated match to d2ibgb1
    complexed with so4

Details for d2ibba1

PDB Entry: 2ibb (more details), 2.4 Å

PDB Description: crystal structure of the first and second fniii domains of ihog
PDB Compounds: (A:) cg9211-pa

SCOPe Domain Sequences for d2ibba1:

Sequence, based on SEQRES records: (download)

>d2ibba1 b.1.2.1 (A:573-676) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gaaldpmpvpelleieeysetavvlhwslasdadehlitgyyayyrpsssageyfkatie
gaharsfkiapletatmyefklqsfsaasasefsalkqgrtqrp

Sequence, based on observed residues (ATOM records): (download)

>d2ibba1 b.1.2.1 (A:573-676) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gaaldpmpvpelleieeysetavvlhwslahlitgyyayyrpsssageyfkatiegahar
sfkiapletatmyefklqsfsaasasefsalkqgrtqrp

SCOPe Domain Coordinates for d2ibba1 are not available.

Timeline for d2ibba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ibba2, d2ibba3