SCOP 1.75: Domain d2ianl1: 2ian L:93-190

Lineage for d2ianl1 (2ian L:93-190)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d2ianl1: 2ian L:93-190 [137172]
   Other proteins in same PDB: d2iana1, d2iana2, d2ianb2, d2ianf1, d2ianf2, d2iang2, d2iank1, d2iank2, d2ianl2, d2ianp1, d2ianp2, d2ianq2
   automatically matched to d1d5xb1
   mutant

Details for d2ianl1

PDB Entry: 2ian, 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR

PDB Compounds: (L:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2ianl1:

Sequence; same for both SEQRES and ATOM records:

>d2ianl1 b.1.1.2 (L:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d2ianl1:

• d2ianl1 first appeared in SCOP 1.73
  
• d2ianl1 appears in SCOPe 2.01
  
• d2ianl1 appears in the current release, SCOPe 2.08