Lineage for d2iank1 (2ian K:83-179)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107077Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1107127Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1107150Domain d2iank1: 2ian K:83-179 [137170]
    Other proteins in same PDB: d2iana2, d2ianb1, d2ianb2, d2ianf2, d2iang1, d2iang2, d2iank2, d2ianl1, d2ianl2, d2ianp2, d2ianq1, d2ianq2
    automatically matched to d1k2da1
    mutant

Details for d2iank1

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (K:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2iank1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iank1 b.1.1.2 (K:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOPe Domain Coordinates for d2iank1:

Click to download the PDB-style file with coordinates for d2iank1.
(The format of our PDB-style files is described here.)

Timeline for d2iank1: