Lineage for d2iang2 (2ian G:2-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938377Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)
  8. 2938397Domain d2iang2: 2ian G:2-92 [137169]
    Other proteins in same PDB: d2iana1, d2iana2, d2iana3, d2ianb1, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl1, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ians1, d2ians2, d2iant1, d2iant2
    automated match to d1klub2
    mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2iang2

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (G:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2iang2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iang2 d.19.1.1 (G:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
dtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeyw
nsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2iang2:

Click to download the PDB-style file with coordinates for d2iang2.
(The format of our PDB-style files is described here.)

Timeline for d2iang2: