Lineage for d2iang1 (2ian G:93-190)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515012Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1515020Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (40 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1515060Domain d2iang1: 2ian G:93-190 [137168]
    Other proteins in same PDB: d2iana1, d2iana2, d2ianb2, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iang2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl2, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianp2, d2ianq2, d2ians1, d2ians2, d2iant1, d2iant2
    automated match to d1klub1
    mutant

Details for d2iang1

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (G:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2iang1:

Sequence, based on SEQRES records: (download)

>d2iang1 b.1.1.2 (G:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d2iang1 b.1.1.2 (G:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypshnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlv
mletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d2iang1:

Click to download the PDB-style file with coordinates for d2iang1.
(The format of our PDB-style files is described here.)

Timeline for d2iang1: