Lineage for d2iana2 (2ian A:5-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938265Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)
  8. 2938278Domain d2iana2: 2ian A:5-81 [137163]
    Other proteins in same PDB: d2iana1, d2iana3, d2ianb1, d2ianb2, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2iang1, d2iang2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2ianl1, d2ianl2, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianq1, d2ianq2, d2ians1, d2ians2, d2iant1, d2iant2
    automated match to d1pywa2
    mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2iana2

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2iana2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iana2 d.19.1.1 (A:5-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
hviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalania
vdkanleimtkrsnytp

SCOPe Domain Coordinates for d2iana2:

Click to download the PDB-style file with coordinates for d2iana2.
(The format of our PDB-style files is described here.)

Timeline for d2iana2: