SCOP 1.73: Domain d2iana1: 2ian A:83-179

Lineage for d2iana1 (2ian A:83-179)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2iana1: 2ian A:83-179 [137162]
   Other proteins in same PDB: d2iana2, d2ianb1, d2ianb2, d2ianf2, d2iang1, d2iang2, d2iank2, d2ianl1, d2ianl2, d2ianp2, d2ianq1, d2ianq2
   automatically matched to d1k2da1
   mutant

Details for d2iana1

PDB Entry: 2ian, 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOP Domain Sequences for d2iana1:

Sequence; same for both SEQRES and ATOM records:

>d2iana1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

Timeline for d2iana1:

• d2iana1 is new in SCOP 1.73
  
• d2iana1 appears in SCOP 1.75
  
• d2iana1 appears in the current release, SCOPe 2.08