Lineage for d2iafa1 (2iaf A:4-148)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2962224Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) (S)
    contains extra C-terminal beta-hairpin
  5. 2962225Family d.81.2.1: Serine dehydratase beta chain-like [143549] (2 proteins)
    Pfam PF03315
  6. 2962226Protein L-serine dehydratase SdhL, N-terminal domain [143550] (1 species)
  7. 2962227Species Legionella pneumophila [TaxId:446] [143551] (2 PDB entries)
    Uniprot Q5ZXE1 17-161
  8. 2962228Domain d2iafa1: 2iaf A:4-148 [137157]
    complexed with mg

Details for d2iafa1

PDB Entry: 2iaf (more details), 2.05 Å

PDB Description: Crystal structure of a fragment (residues 11 to 161) of L-serine dehydratase from Legionella pneumophila
PDB Compounds: (A:) Hypothetical protein sdhL

SCOPe Domain Sequences for d2iafa1:

Sequence, based on SEQRES records: (download)

>d2iafa1 d.81.2.1 (A:4-148) L-serine dehydratase SdhL, N-terminal domain {Legionella pneumophila [TaxId: 446]}
sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn
anllieqvyysigggfitteedfdk

Sequence, based on observed residues (ATOM records): (download)

>d2iafa1 d.81.2.1 (A:4-148) L-serine dehydratase SdhL, N-terminal domain {Legionella pneumophila [TaxId: 446]}
sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
esmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgnanlli
eqvyysigggfitteedfdk

SCOPe Domain Coordinates for d2iafa1:

Click to download the PDB-style file with coordinates for d2iafa1.
(The format of our PDB-style files is described here.)

Timeline for d2iafa1: